PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vun000532
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family ARF
Protein Properties Length: 565aa    MW: 63277 Da    PI: 8.8119
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-167a-Vigna_unguiculata-26343PU_refplantGDBView CDS
gnl|UG|Vun#S45847148PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B352.21.1e-161584099
               ETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
         B3 40 desgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99
               d++g++W++++i+r++++r++lt+GW+ Fv+a++L +gD+v+F   ++++ +l+++++r+
  Vun000532  1 DLHGNEWKFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFI--WNEKNQLLLGIRRA 58
               689*****************************************..8899999****997 PP

2Auxin_resp121.56.5e-4083166183
  Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalk.vkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                 aahaa+t+s F+++YnPras+seFv++++k++ka++ ++vsvGmRf+m fete+ss rr++Gt++g+sdldp rWpnS+Wrs+k
   Vun000532  83 AAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYhTRVSVGMRFRMLFETEESSVRRYMGTITGISDLDPARWPNSHWRSVK 166
                 79*********************************9789******************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.107.9E-23172IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.858159IPR003340B3 DNA binding domain
CDDcd100172.99E-12157No hitNo description
PfamPF023622.0E-14158IPR003340B3 DNA binding domain
SuperFamilySSF1019361.96E-20186IPR015300DNA-binding pseudobarrel domain
PfamPF065077.4E-3583166IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 565 aa     Download sequence    Send to blast
DLHGNEWKFR HIFRGQPKRH LLTTGWSVFV SAKRLVAGDS VLFIWNEKNQ LLLGIRRANR  60
PQTVMPSSVL SSDSMHLGLL AAAAHAAATN SRFTIFYNPR ASPSEFVIPL AKYVKAVYHT  120
RVSVGMRFRM LFETEESSVR RYMGTITGIS DLDPARWPNS HWRSVKVGWD ESTAGERQPR  180
VSLWEIEPLT TFPMYPSPFP LRLKRPWPPG LPSFHGMKDD DFGLNSSLLW LRDSDRGLQS  240
PTFQGIGVNP WMQPRFDPSM LNMSTDMYQA AAAAAAVQEM RGLDPSKQHS ASILQFQQPQ  300
NFPNRTAAFV QAQMLQQPQH QQIFGNNQEN QHSPQSQLQT QAHLQQHLQH QHSFNTQHHH  360
QHQQQQLRQT QQQQQQQQVV DNQQISSAVS SMSQFVSAPP PQSPPMQAIS SLCQQQNFSD  420
SNGNSVPTIV SPLHSILGSF PQDETSHLLN LPRTSSWIPV QNSTGWPSKR VAVDPLLSTG  480
VSQCVLPQVE QLGQPQSTVS QNAITLPPFP GRECSIDQEG SNDPQNHLLF GVNIDSTSLL  540
MPNGMSTLKG VSSNNDSSTM PYQSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-831187202388Auxin response factor 5
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014518367.10.0PREDICTED: auxin response factor 6
SwissprotA2X1A10.0ARFF_ORYSI; Auxin response factor 6
SwissprotQ6H6V40.0ARFF_ORYSJ; Auxin response factor 6
TrEMBLA0A0L9VEW00.0A0A0L9VEW0_PHAAN; Auxin response factor
TrEMBLA0A0S3S3860.0A0A0S3S386_PHAAN; Auxin response factor
STRINGGLYMA15G09750.20.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30330.21e-171auxin response factor 6